PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 1722aa    MW: 188112 Da    PI: 6.7003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233343.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.4e-10804847247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE el+++  +  G++ +++Ia+ +  ++t  +c+++++k+
   XP_008233343.1 804 NPWTPEEKELFIEKLTTCGKD-FRKIASFLD-HKTTADCVEFYYKH 847
                      69*****************99.*********.************97 PP

2Myb_DNA-binding262.2e-0810231063345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT  E   +++av  +G++ ++ I+r++  +R+  qck ++ 
   XP_008233343.1 1023 DWTDAEKSSFIQAVSSYGKD-FAMISRCVR-TRSQHQCKVFFS 1063
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.93E-14789850IPR009057Homeodomain-like
PROSITE profilePS5129316.793801852IPR017884SANT domain
SMARTSM007171.9E-10802850IPR001005SANT/Myb domain
PfamPF002491.5E-7804847IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-7805849IPR009057Homeodomain-like
PROSITE profilePS5129311.00210191070IPR017884SANT domain
SMARTSM007177.5E-610201068IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-910211070IPR009057Homeodomain-like
PfamPF002494.1E-610231063IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-510231064IPR009057Homeodomain-like
CDDcd001676.19E-510241062No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1722 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSESLGSVAR WRDSPHHAPR DFNRWPSADF RRPPGHGKQG  60
GWHLFSEDSG HGYTSSRSGD KMLEDESCRP SFSRGDGRYG RNSRDNRGSY SQRECKGHSW  120
ETSSGSPNTP GRPNDVINEQ RTQDDMLTYS SHPHSDFGST WDQIQLKDQL DRMGGSTGLG  180
AGQKCERENS LGSIDWKPLK WTRSGSMSSR GSGFSHSSSS KSIGAIDFNE AKVESQQKNA  240
TPVQSPSGEA TTCVTSAAPS EETTSRKKPR LGWGEGLAKY EKKKVEVPDG SMNKDGVVCS  300
VGNMEPVHSL SSNLADKSPR VTVFSDCASP ATPSSVACSS SPGVEEKSFG KTANVDNNNR  360
NFCGSPGPMF QSHHEGFTFN LEKLDCNSIA NLGSSLRELL QSDDPSSVDS GIVRPTAMNK  420
LLIWKGEISK VLEVTESEID SLENELKVLN SDSRGSCPRP ATSSSLPVED NDKSFKEQVT  480
VTNLITRPAP LQIHSSGDTD AEKMCLGNGD QVEFCGIVKD EDIDSPGTAT SKFVEPLPLV  540
KVVSSSDVMS HKDCSGDLDP IETTKGEAKC LVPGKYEEKT DLSACGNSSM LLGSEIVAPV  600
SGGSGLCFSV VDTICDSICS SNKESANRSF DVFNKLLPRE HYKVDISGVS ISSSGKNDSL  660
IKEKFAMRKR RLRFMERVLT LKYKAFQHLW KEDLRLLSIR KYRPKSHKKI ELSLRATNNG  720
YQKHRSSIRS RFSTPGNRXX XXXXXIINFT NKLLSDSQVK RYRNSLKMPA LILDKKEKMV  780
TRFISSNGLV EDPCVVEKER ALMNPWTPEE KELFIEKLTT CGKDFRKIAS FLDHKTTADC  840
VEFYYKHHKS VCFEKTKKKA DMTKQGKSSA KTYLISNGKK WNREMNAASL DILGAASAIA  900
AHADGSTRSR QAYSGRLFLE GYRNTNPSRG DDTTVERSCS FDAIGNERET VAADVLAGIC  960
GSLSSEAVSS CITSSIDPGE GYREWKCQKV DSLARRPLTP DVMQNVDDET CSEESCGEMD  1020
PSDWTDAEKS SFIQAVSSYG KDFAMISRCV RTRSQHQCKV FFSKARKCLG LDLVHPVAGN  1080
GTSVGDDVNG GGSDTEDACV LETGSGISSD KSGCRMNEDM PLSVINMDDE SDPAETMNLQ  1140
TGPRRSEENN VMGQLDHEGG QTLKSLASDA LEVEDRPNLV LDDADCVRDA QRSRVFSADA  1200
LKDDVAEKGI LIAESEPVGG GINFDPTNPG MDGEKLMGEH SSDGNTDTSR CSLPGSVHDS  1260
NSSGNASALA GGGSCSGFSL NPECLHQVSV GLNSMQKPSV ISMPHENRHA PADSVSQDSA  1320
KIECEKAFNQ DRLSSTLDLQ EGREPKSVGI DECHQHLPGL PVYTNVESSQ VLKGYPLQMA  1380
TKKDTNGDVT SGNLSEVQNF SKPDRKINGH YMTKDGFLQF GNCRPQCSEV DFPLAPQKVE  1440
QPVGPPKAHS WSSSDSDKPS KNGDVKLFGK ILSNPSSLSK SISNIHENEE KGAHNHKLSN  1500
TSSNLKFTGH HNADGNSSLL KFDCSSYLGI EKVPRRSYGF WEGNKVHSGY PSFSDSAILL  1560
AKYPAAFGNF PTTSSKMEQQ PLQAVVKNND RNINGVSVFP SREISGSNGV VDYPVFSRSR  1620
DGAKVPPFTV DVKQQQRQDV FDMPRRNGFD TISSLQQQGR GIVGMNVVGR GGILVGGPCT  1680
GVSDPVAAIR MHYAKTEQYG GQPGSMIREE ESWRGGKGDV GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D3e-15768850990NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C3e-15768850990NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233343.10.0PREDICTED: uncharacterized protein LOC103332387
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-174MYB family protein